Hotlist · 2026-05-27
Every .ca domain expiring this drop, with a curated category and rationale. Built from the name alone — no backlinks. Curated categories are inlined and filterable.
Domains
9,719
Curated
9,014
non-skip picks
Single-word
82
dictionary match
Compound
2,914
two words joined
Short-premium
163
2–4 letters, clean
SEO
108
high link signal
| # | Domain· | Pick | Len· | Age· | TF· | CF· | DA· | Alt· | Dict words |
|---|---|---|---|---|---|---|---|---|---|
| 8651 | meccooperativedepleinair.calikely available | nicheNiche: MEC (Mountain Equipment Co-op) + cooperative + outdoor French phrase. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8652 | richmondhillchiropractor.calikely available | geoGeo-local: Richmond Hill (Ontario) + 'chiropractor'; healthcare. | 24 | — | 0 | 2 | 3 | 1/11 | — |
| 8653 | myhomecarenurseeducation.calikely available | keywordCompound: 'my' + 'homecare' + 'nurse' + 'education'. Multi-word healthcare education service. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8654 | thehealingtreedispensary.calikely available | keywordThree-concept compound: 'healing tree' + 'dispensary' for wellness/cannabis positioning. | 24 | — | 0 | 5 | 1 | 0/11 | — |
| 8655 | panamapropertymanagement.calikely available | keywordCompound keyword: 'panama', 'property', 'management' targets offshore property services. | 24 | — | 0 | 0 | 1 | 1/11 | — |
| 8656 | cloudaccountingsolutions.calikely available | keywordCompound keyword: 'cloud', 'accounting', 'solutions' targets SaaS accounting firm. | 24 | — | 0 | 2 | 1 | 2/11 | — |
| 8657 | indigenousstudentsmatter.calikely available | keywordCompound: 'indigenous' + 'students' + 'matter' social justice phrase. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8658 | lakesidecottagevacations.calikely available | keywordCompound: 'lakeside' + 'cottage' + 'vacations', tourism/rental business keywords. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8659 | lmsreinforcingsteelgroup.calikely available | nicheNiche: 'lms' + 'reinforcing' + 'steel' + 'group' construction materials company. | 24 | — | 0 | 2 | 1 | 0/11 | — |
| 8660 | meganheyhurstphotography.calikely available | nicheNiche photography service using personal name + service type. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8661 | hometownsportsexcellence.calikely available | keywordCompound: hometown + sports + excellence. Youth sports/coaching community service. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8662 | caribbeanqueenjerkbuffet.calikely available | keywordCompound keywords caribbean+queen+jerk+buffet for food business | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8663 | fondementsdelacroissance.calikely available | keywordCompound keywords fondements+de+la+croissance, French business growth | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8664 | marinamarshallproperties.calikely available | nichePersonal name + 'properties'; real estate niche targeting residential sales. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8665 | jessicascleaningservices.calikely available | nicheNiche personal brand; Jessica's name + service type targets cleaning business identity. | 24 | — | 0 | 0 | 1 | 1/11 | — |
| 8666 | onlinesingingmasterclass.calikely available | keywordThree-word compound: online+singing+masterclass. Extended length (24 chars) targets educational service seekers. | 24 | — | 0 | 1 | 1 | 0/11 | — |
| 8667 | northernsustainablefarms.calikely available | keywordCompound: 'northern' + 'sustainable farms' targets eco-agriculture operations. | 24 | — | 0 | 0 | 1 | 1/11 | — |
| 8668 | peakexecutivecounselling.calikely available | nicheNiche executive coaching; 'peak' suggests premium professional counseling services. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8669 | brightmindsearlylearning.calikely available | nicheNiche: Child care/education service; developmental focus in branding. | 24 | — | 0 | 0 | 1 | 1/11 | — |
| 8670 | privatepracticeblueprint.calikely available | keywordPrivate + practice + blueprint; three-part compound for professional service planning/consulting. | 24 | — | 0 | 0 | 1 | 2/11 | — |
| 8671 | aspenandbloomphotography.calikely available | keywordCompound: aspen + bloom + photography. Scenic/nature photography services brand. | 24 | — | 0 | 0 | 1 | 1/11 | — |
| 8672 | nutritionnisteterrebonne.calikely available | geoGeo_local: 'nutritionniste' (French) + 'Terrebonne' (Quebec city) for local nutrition services. | 24 | — | 0 | 5 | 10 | 1/11 | — |
| 8673 | independentrealtysudbury.calikely available | geoGeographic local: Sudbury-specific independent real estate brokerage branch. | 24 | — | 0 | 11 | 7 | 0/11 | — |
| 8674 | youngprintersassociation.calikely available | nicheMulti-word phrase; niche trade association for young printing professionals. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8675 | buyyourdreamhomewithease.calikely available | keywordDescriptive real estate messaging. Long-tail benefit phrase positioning. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8676 | thenorthcleaningservices.calikely available | geoGeo+service: The North + cleaning. Regional cleaning contractor serving northern area. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8677 | grindstoneblendswellness.calikely available | keywordGrindstone blends + wellness; herbal or beverage wellness brand compound. | 24 | — | 0 | 0 | 1 | 1/11 | — |
| 8678 | perfectlyimperfectdesign.calikely available | keywordPerfectly imperfect + design; aesthetic design philosophy compound brand concept. | 24 | — | 0 | 0 | 1 | 2/11 | — |
| 8679 | metalformingnewfoundland.calikely available | geoGeo-local: 'metal forming' + Newfoundland. Regional manufacturing specialization. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8680 | saffronstaffingsolutions.calikely available | keywordCompound keyword: 'saffron' (color brand) + 'staffing solutions'. HR recruitment agency. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8681 | martinfrithchanginglives.calikely available | nicheNiche: Personal name + mission 'Martin Frith changing lives'. Individual coaching/mentoring. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8682 | rockypointmassagetherapy.calikely available | keywordCompound: 'rocky' + 'point' + 'massage' + 'therapy'; place + service keywords. | 24 | — | 0 | 7 | 1 | 0/11 | — |
| 8683 | ontariointernetmarketing.calikely available | keywordCompound: 'ontario' + 'internet' + 'marketing'; provincial + digital marketing services. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8684 | firefightercancerproject.calikely available | keywordThree-word compound: firefighter + cancer + project describes health advocacy initiative. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8685 | lakecountryexoticcraving.calikely available | keywordFour-word compound: lake country + exotic + craving; specialty food/dining venue. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8686 | conceptcapitalmanagement.calikely available | keywordThree-part compound: concept + capital + management; finance/investment services. | 24 | — | 0 | 4 | 1 | 1/11 | — |
| 8687 | canadiandynamicmortgages.calikely available | keywordCompound: 'canadian' + 'dynamic' + 'mortgages' targets mortgage lending services. | 24 | — | 0 | 11 | 2 | 0/11 | — |
| 8688 | ottawaweddingphotography.calikely available | geoGeographic: 'ottawa' + 'wedding' + 'photography' targets local wedding photographer services. | 24 | — | 0 | 0 | 1 | 1/11 | — |
| 8689 | yourcandidatesyourhealth.calikely available | keywordCompound: 'your candidates' + 'your health' targets healthcare recruiting or wellness programs. | 24 | — | 9 | 9 | 11 | 1/11 | — |
| 8690 | metaverserealestatevalue.calikely available | keywordCompound metaverse + real estate + value; crypto/NFT property investment focus. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8691 | procareheatingandcooling.calikely available | keywordCompound ProCare + HVAC; professional heating/cooling contractor or distributor. | 24 | — | 0 | 10 | 5 | 0/11 | — |
| 8692 | willoakturfandlandscapes.calikely available | keywordWillow + oak + turf + landscapes; landscaping company with nature imagery. | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8693 | resilientsoulscollective.calikely available | keywordThree-word compound: resilient + souls + collective; wellness/community niche. | 24 | — | 0 | 0 | 1 | 1/11 | — |
| 8694 | constructiondatasciences.calikely available | keywordCompound: construction + data + sciences (three sector keywords). | 24 | — | 0 | 0 | 1 | 0/11 | — |
| 8695 | cprfirstaidcertification.calikely available | keywordCompound: CPR + first aid + certification (training keywords). | 24 | — | 0 | 0 | 1 | 1/11 | — |
| 8696 | calgaryadulthydrocephalus.calikely available | geoCalgary + adult + hydrocephalus; medical geo-local compound; 25 letters, niche. | 25 | — | 0 | 3 | 1 | 0/11 | — |
| 8697 | grassrootswomensgathering.calikely available | keywordCompound: grassroots + womens + gathering. Community event descriptor. | 25 | — | 0 | 0 | 1 | 1/11 | — |
| 8698 | rewiredrecoveryfoundation.calikely available | keywordCompound: 'rewired recovery' + 'foundation'; targets addiction/rehabilitation nonprofit. | 25 | — | 0 | 0 | 1 | 0/11 | — |
| 8699 | accessiblehomerenovations.calikely available | keywordThree keywords: 'accessible,' 'home,' 'renovations'—service descriptor for accessibility-focused renovations. | 25 | — | 0 | 5 | 1 | 1/11 | — |
| 8700 | buildoneprojectmanagement.calikely available | nicheNiche: build one + project management combining construction with service descriptor. | 25 | — | 0 | 0 | 1 | 0/11 | — |
Page 174 of 181 · 9,014 matches