Hotlist · 2026-06-24
Every .ca domain expiring this drop, with a curated category and rationale. Built from the name alone — no backlinks. Curated categories are inlined and filterable.
Domains
9,984
Curated
9,233
non-skip picks
Single-word
177
dictionary match
Compound
2,974
two words joined
Short-premium
157
2–4 letters, clean
SEO
149
high link signal
| # | Domain· | Pick | Len· | Age· | TF· | CF· | DA· | Alt· | Dict words |
|---|---|---|---|---|---|---|---|---|---|
| 8451 | goldenbridgehomecare.calikely available | nicheGolden bridge home care—senior care service niche descriptor. | 20 | 1y | 0 | 8 | 5 | 0/11 | — |
| 8452 | modelcontextprotocol.calikely available | nicheTechnical niche; AI/protocol standards industry terminology. | 20 | 1y | 0 | 0 | 1 | 9/11 | — |
| 8453 | virtualcareinsurance.calikely available | nicheNiche healthcare; 'virtual care' + 'insurance' business model. | 20 | 6y | 0 | 0 | 1 | 0/11 | — |
| 8454 | flooringcanadaonline.calikely available | nicheNiche: flooring + Canada + online; geo-focused e-commerce descriptor. | 20 | 5y | 0 | 0 | 1 | 0/11 | — |
| 8455 | privatelabelproducts.calikely available | nicheNiche: private label + products; B2B manufacturing/wholesale positioning. | 20 | 11y | 0 | 3 | 1 | 5/11 | — |
| 8456 | theinvisibleelephant.calikely available | nicheNiche: poetic phrase referencing unaddressed issues; consulting/advisory focus. | 20 | 0y | 0 | 0 | 1 | 1/11 | — |
| 8457 | torontoguitaracademy.calikely available | geoGeo-local: 'Toronto' + 'guitar' + 'academy', education Toronto. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8458 | montrealguitarschool.calikely available | geoGeographic: Montreal + guitar school, music education institution brand. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8459 | floralchaptersottawa.calikely available | geoGeo-local: 'floral chapters' + 'Ottawa' (capital) for flower business. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8460 | heartpatientalliance.caregistered | nicheNiche: 20-character medical/advocacy phrase, health organization signal. | 20 | 9y | 14 | 13 | 16 | 0/11 | — |
| 8461 | jplprogrammationtest.calikely available | nicheTechnical niche; 20 characters, specialized programming/development focus. | 20 | 2y | 0 | 0 | 1 | 0/11 | — |
| 8462 | pyramidsheetmetalwpg.caregistered | nicheNiche; 'pyramid' + 'sheetmetal' + Winnipeg local, 20 characters. | 20 | 2y | 0 | 0 | 1 | 0/11 | — |
| 8463 | senioronsiteservices.calikely available | nicheNiche phrase; senior care/home services, 20 characters. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8464 | alwaysbettercoaching.calikely available | nicheBranded phrase. Niche coaching tagline concept without recognized keyword components. | 20 | 2y | 0 | 0 | 1 | 1/11 | — |
| 8465 | centrestonefinancial.calikely available | nicheNiche branded concept. Multi-word financial services phrase without core keywords. | 20 | 4y | 0 | 0 | 1 | 1/11 | — |
| 8466 | kscommercialtraining.calikely available | nicheNiche branded phrase. Acronym + commercial training without recognized keywords. | 20 | 3y | 0 | 0 | 1 | 0/11 | — |
| 8467 | jazzyjewelrybyaudrey.calikely available | nicheNiche branded concept. Creator-attributed jewelry phrase without core keyword signals. | 20 | 3y | 0 | 0 | 1 | 0/11 | — |
| 8468 | relationshipcodebook.calikely available | nicheNiche branded concept. Relationship advice concept without recognized keyword components. | 20 | 8y | 0 | 0 | 1 | 1/11 | — |
| 8469 | yfmlimousineservices.calikely available | nicheNiche branded phrase. Acronym + luxury transportation without core keyword signals. | 20 | 2y | 0 | 0 | 1 | 0/11 | — |
| 8470 | livinganembodiedlife.calikely available | nicheWellness/mindfulness philosophy phrase; niche lifestyle coaching or self-help sector. | 20 | 3y | 0 | 0 | 1 | 0/11 | — |
| 8471 | constructionturnbull.calikely available | nicheNiche contractor; 'Turnbull Construction' company identifier, personalized builder branding. | 20 | 12y | 0 | 0 | 1 | 0/11 | — |
| 8472 | theflourishingneedle.calikely available | nicheNiche craft; embroidery/needlework business; artisanal crafts retail/instruction brand. | 20 | 1y | 0 | 4 | 4 | 0/11 | — |
| 8473 | thehappyhousehusband.calikely available | nicheNiche lifestyle brand; the + happy + house + husband; domestic/family content focus. | 20 | 8y | 0 | 0 | 1 | 1/11 | — |
| 8474 | smartsurvivalsystems.calikely available | nicheNiche: 'smart' + 'survival' + 'systems'—preparedness/emergency equipment niche. | 20 | 8y | 0 | 3 | 1 | 2/11 | — |
| 8475 | aviationcanadaonline.calikely available | nicheNiche service: aviation + Canada + online – industry portal descriptor. | 20 | 5y | 0 | 0 | 1 | 0/11 | — |
| 8476 | projetfeuillederable.calikely available | nicheNiche; French phrase for 'maple leaf project' targeting Francophone Quebec market. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8477 | luxuriacondobytridel.calikely available | keywordCompound 'Luxuria' + 'condo' + 'by Tridel'; branded luxury residential property. | 20 | 5y | 0 | 0 | 1 | 0/11 | — |
| 8478 | truthaboutseniorcare.calikely available | niche20-char niche; 'truth' + 'senior care' positions educational/advocacy senior services. | 20 | 8y | 0 | 0 | 1 | 0/11 | — |
| 8479 | lifestepscounselling.caregistered | nicheNiche: life steps + counselling; healthcare service. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8480 | optimalcybersecurity.calikely available | keywordCompound: 'optimal' + 'cyber' + 'security' positions best-in-class security solutions. | 20 | 1y | 0 | 0 | 2 | 0/11 | — |
| 8481 | thesketchycatjournal.calikely available | nicheNiche: 'The' + 'sketchy' + 'cat' + 'journal' art/creative publication featuring cats. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8482 | detoxnorthernontario.calikely available | geoNorthern Ontario geography + detox service for regional targeting. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8483 | rehabnorthernontario.calikely available | geoNorthern Ontario location + rehab service descriptor. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8484 | noblehomeinspections.calikely available | keywordNiche home inspection service with premium brand angle. | 20 | 1y | 0 | 0 | 1 | 1/11 | — |
| 8485 | coehillcountrymarket.calikely available | nicheNiche rural market combining Coe Hill location + marketplace. | 20 | 4y | 0 | 0 | 1 | 0/11 | — |
| 8486 | envisionfloralstudio.caregistered | nicheNiche domain: florist business name combining vision with floral design studio. | 20 | 10y | 1 | 10 | 10 | 0/11 | — |
| 8487 | kelownahousepainting.calikely available | geoGeo-local: 'Kelowna' (BC city) + 'house painting' targets local home services. | 20 | 1y | 0 | 0 | 1 | 1/11 | — |
| 8488 | fordextendedwarranty.calikely available | keywordCompound keyword: 'Ford' + 'extended warranty' targets vehicle warranty or protection plans. | 20 | 21y | 0 | 0 | 1 | 1/11 | — |
| 8489 | worldteahousemarkham.calikely available | geoGeo-local: 'Markham' (Ontario city) + 'world tea house' targets local tea café. | 20 | 3y | 0 | 0 | 1 | 1/11 | — |
| 8490 | trucoastdevelopments.calikely available | keywordCompound keyword: 'Tru Coast' + 'developments' brands regional construction or real estate firm. | 20 | 9y | 0 | 0 | 1 | 0/11 | — |
| 8491 | taskmasterprolimited.calikely available | nicheNiche: 'taskmaster pro' + corporate suffix; service positioning. | 20 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8492 | saunaevasionrimouski.calikely available | geoGeo-local: Rimouski + 'sauna evasion'; spa service location anchor. | 20 | 2y | 0 | 0 | 1 | 0/11 | — |
| 8493 | michaelgesualdiwealth.calikely available | keywordCompound keyword: 'Michael Gesualti' (name) + 'wealth'; financial advisor branding. | 21 | 14y | 0 | 5 | 1 | 0/11 | — |
| 8494 | couturehairextensions.calikely available | keywordCompound keyword: 'couture' + 'hair extensions' targets luxury hair services/products. | 21 | 2y | 0 | 0 | 1 | 0/11 | — |
| 8495 | electricvehiclesource.calikely available | keywordCompound keyword: 'electric vehicle' + 'source' targets EV sales/supply chain sector. | 21 | 6y | 0 | 0 | 1 | 0/11 | — |
| 8496 | creaturesofcreativity.calikely available | keywordCompound keyword: 'creatures' + 'of creativity' targets artistic/creative services marketplace. | 21 | 6y | 0 | 0 | 1 | 0/11 | — |
| 8497 | goldencreationscanada.calikely available | keywordMerges 'golden creations' and 'Canada' into 21-character artisan compound. | 21 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8498 | turnaboutlasertherapy.calikely available | keywordMerges 'turnabout', 'laser', 'therapy' into 21-character medical compound. | 21 | 7y | 0 | 9 | 2 | 0/11 | — |
| 8499 | pattrudeauphotography.calikely available | keywordCompound: pat + trudeau + photography. Name with profession, 21 characters. | 21 | 1y | 0 | 0 | 1 | 0/11 | — |
| 8500 | theinfinitewealthplan.calikely available | keywordDescriptive phrase combining 'infinite' with 'wealth plan' financial concept. | 21 | 4y | 0 | 0 | 1 | 0/11 | — |
Page 170 of 185 · 9,233 matches